PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_36879.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YB
Protein Properties Length: 80aa    MW: 9047.34 Da    PI: 5.1632
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_36879.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB150.72.9e-471791795
         NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                  mkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfe+y+eplkvyl+kyre++g
  MLOC_36879.2  1 MKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEEYIEPLKVYLQKYREADG 79
                  9***************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.77E-31177IPR009072Histone-fold
PfamPF008083.5E-22155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.0E-42178IPR009072Histone-fold
PRINTSPR006152.0E-231937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.0E-233856No hitNo description
PRINTSPR006152.0E-235775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MKKAIPANGK IAKDAKETVQ ECVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMATLGF  60
EEYIEPLKVY LQKYREADGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-401761893NF-YB
4csr_A1e-401761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B1e-401761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3641761e-125AK364176.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2022G14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001106052.21e-50nuclear transcription factor Y subunit B
RefseqNP_001141333.11e-50CAAT box binding protein 1
RefseqXP_003568278.12e-50PREDICTED: nuclear transcription factor Y subunit B
RefseqXP_008654576.11e-50PREDICTED: CAAT box binding protein1 isoform X1
SwissprotP252092e-52NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBLM0VSH98e-54M0VSH9_HORVD; Uncharacterized protein
STRINGMLOC_36879.45e-51(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.19e-51nuclear factor Y, subunit B3